Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Zm00001d025134_circ_g.3 |
ID in PlantcircBase | zma_circ_010285 |
Alias | Zm10circ00039, zma_circ_0003204, GRMZM2G323754_C3 |
Organism | Zea mays |
Position | chr10: 105955563-105956369 JBrowse» |
Reference genome | AGPv4.38 |
Type | e-circRNA |
Identification method | CIRI2, find_circ |
Parent gene | Zm00001d025134 |
Parent gene annotation |
protein_coding |
Parent gene strand | + |
Alternative splicing | Zm00001d025134_circ_g.2 |
Support reads | NA |
Tissues | leaf, endosperm, root |
Exon boundary | Yes-Yes |
Splicing signals | GT-AG |
Number of exons covered | Zm00001d025134_T003:3 Zm00001d025134_T002:3 Zm00001d025134_T008:3 Zm00001d025134_T005:3 Zm00001d025134_T007:3 Zm00001d025134_T006:3 Zm00001d025134_T004:3 Zm00001d025134_T001:3 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.190715478 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
105955751-105955595(+) |
Potential amino acid sequence |
MLDALGILPQRKQHKKLLLQALVGEDLAETQLFSSSSSLTDDSICSDFDIYVRKLQGTLAVLYH RRR*(+) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | responsive to drought stress |
Other Information | |
---|---|
References | Han et al., 2020; Ma et al., 2021b;Zhang et al., 2019 |