Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Zm00001d025134_circ_g.3 |
| ID in PlantcircBase | zma_circ_010285 |
| Alias | Zm10circ00039, zma_circ_0003204, GRMZM2G323754_C3 |
| Organism | Zea mays |
| Position | chr10: 105955563-105956369 JBrowse» |
| Reference genome | AGPv4.38 |
| Type | e-circRNA |
| Identification method | CIRI2, find_circ |
| Parent gene | Zm00001d025134 |
| Parent gene annotation |
protein_coding |
| Parent gene strand | + |
| Alternative splicing | Zm00001d025134_circ_g.2 |
| Support reads | NA |
| Tissues | leaf, endosperm, root |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Zm00001d025134_T003:3 Zm00001d025134_T002:3 Zm00001d025134_T008:3 Zm00001d025134_T005:3 Zm00001d025134_T007:3 Zm00001d025134_T006:3 Zm00001d025134_T004:3 Zm00001d025134_T001:3 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.190715478 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
105955751-105955595(+) |
| Potential amino acid sequence |
MLDALGILPQRKQHKKLLLQALVGEDLAETQLFSSSSSLTDDSICSDFDIYVRKLQGTLAVLYH RRR*(+) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | responsive to drought stress |
| Other Information | |
|---|---|
| References | Han et al., 2020; Ma et al., 2021b;Zhang et al., 2019 |