Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os03g0235100_circ_g.2 |
| ID in PlantcircBase | osa_circ_018752 |
| Alias | Os_ciR3887 |
| Organism | Oryza sativa |
| Position | chr3: 7134617-7135047 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | find_circ |
| Parent gene | Os03g0235100 |
| Parent gene annotation |
Similar to Pg4. (Os03t0235100-01);Similar to Pg4. (Os03t0235100- 02) |
| Parent gene strand | + |
| Alternative splicing | NA |
| Support reads | 2 |
| Tissues | root |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Os03t0235100-01:2 Os03t0235100-02:2 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.304629234 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
7135013-7134696(+) 7134962-7135039(-) |
| Potential amino acid sequence |
MLPFLQAKVMRKILDTNPQLYFHLQQQKLIELIRAGKINEALEFAQEELAPRGEENQVFLEEIE KTVALLVFEDIKNCPYGELLDVSQRLKTASEVNAAILTSQSHEKDSGHKSPTVLSSATTEANRI DSCGKNK*(+) MDSSLYLQKPKVLQFSLFLQERLDFLRLLERVLLVQTPKLHLFFPHESILLASVVADESTVGDL CPESFS*(-) |
| Sponge-miRNAs | osa-miR2873c |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Ye et al., 2015 |