Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os04g0103200_circ_g.6 |
| ID in PlantcircBase | osa_circ_022874 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr4: 222279-222417 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer |
| Parent gene | Os04g0103200 |
| Parent gene annotation |
Proteasome component region PCI domain containing protein. (Os04 t0103200-01);Proteasome component region PCI domain containing p rotein. (Os04t0103200-02) |
| Parent gene strand | - |
| Alternative splicing | Os04g0103200_circ_g.4 Os04g0103200_circ_g.5 Os04g0103200_circ_g.7 |
| Support reads | 1 |
| Tissues | shoot |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Os04t0103200-01:1 Os04t0103200-02:1 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.445890108 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
222334-222282(+) |
| Potential amino acid sequence |
MSSAICRASSWDRALVTRLQMIARMHSRYFEAQGRFVLGLVGELGADEFGDLQGLVLGSGLGDE VADDSEDALEIL*(+) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |