Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os11g0629200_circ_g.3 |
| ID in PlantcircBase | osa_circ_009831 |
| Alias | Os_ciR7141 |
| Organism | Oryza sativa |
| Position | chr11: 24645992-24646167 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer, circseq_cup, find_circ |
| Parent gene | Os11g0629200 |
| Parent gene annotation |
Similar to Vacuolar sorting protein-like; embryogenesis protein H beta 58-like protein. (Os11t0629200-01) |
| Parent gene strand | + |
| Alternative splicing | NA |
| Support reads | 2/2/2 |
| Tissues | root/root/shoot, root |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Os11t0629200-01:1 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.767362879 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
24646060-24646008(+) 24646000-24646027(-) |
| Potential amino acid sequence |
MELEIRRRESTGSGPGTYIETETLAKFELMDGAPVRGTISRM*(+) MVPLTGAPSINSNFASVSVSIYVPGPDPVDSRRRISSSMFFIFILTRRK*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Ye et al., 2015;Ye et al., 2016;Chu et al., 2017 |