Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os01g0901000_circ_g.2 |
| ID in PlantcircBase | osa_circ_005284 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr1: 39224821-39225443 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | ue-circRNA |
| Identification method | CIRCexplorer |
| Parent gene | Os01g0901000 |
| Parent gene annotation |
Similar to Arm repeat-containing protein. (Os01t0901000-01);Simi lar to predicted protein. (Os01t0901000-02) |
| Parent gene strand | - |
| Alternative splicing | NA |
| Support reads | 2 |
| Tissues | shoot, root |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Os01t0901000-01:3 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | osi_circ_011073 |
| PMCS | 0.281388911 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
39225416-39224872(+) 39225418-39225425(-) |
| Potential amino acid sequence |
MVNYHQSSNILQPISSVTMPSTRLRLS*(+) MDAMEAEEGPFLANDAKLHAGMYRAFHPAVSKLVAIFPFIEASRPRSKSGIQALCSLHVALDKA KGLLQHCADCSRLYLAITAETVLLKFEKARTQLQESLRRVEGIVTEEIGCKMLELWW*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |