Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os01g0901000_circ_g.2 |
ID in PlantcircBase | osa_circ_005284 |
Alias | NA |
Organism | Oryza sativa |
Position | chr1: 39224821-39225443 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | ue-circRNA |
Identification method | CIRCexplorer |
Parent gene | Os01g0901000 |
Parent gene annotation |
Similar to Arm repeat-containing protein. (Os01t0901000-01);Simi lar to predicted protein. (Os01t0901000-02) |
Parent gene strand | - |
Alternative splicing | NA |
Support reads | 2 |
Tissues | shoot, root |
Exon boundary | Yes-Yes |
Splicing signals | CT-AC |
Number of exons covered | Os01t0901000-01:3 |
Conservation Information | |
---|---|
Conserved circRNAs | osi_circ_011073 |
PMCS | 0.281388911 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
39225416-39224872(+) 39225418-39225425(-) |
Potential amino acid sequence |
MVNYHQSSNILQPISSVTMPSTRLRLS*(+) MDAMEAEEGPFLANDAKLHAGMYRAFHPAVSKLVAIFPFIEASRPRSKSGIQALCSLHVALDKA KGLLQHCADCSRLYLAITAETVLLKFEKARTQLQESLRRVEGIVTEEIGCKMLELWW*(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Chu et al., 2017 |