Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os01g0372866_circ_g.1 |
ID in PlantcircBase | osa_circ_001747 |
Alias | Os_ciR2561 |
Organism | Oryza sativa |
Position | chr1: 15358052-15358181 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | e-circRNA |
Identification method | CIRCexplorer, find_circ |
Parent gene | Os01g0372700 |
Parent gene annotation |
Similar to Asparaginyl-tRNA synthetase, cytoplasmic 1 (EC 6.1.1. 22) (Asparagine-- tRNA ligase 1) (AsnRS 1). (Os01t0372700-01) |
Parent gene strand | - |
Alternative splicing | NA |
Support reads | 6/1 |
Tissues | root/shoot, root |
Exon boundary | Yes-Yes |
Splicing signals | CT-AC |
Number of exons covered | Os01t0372866-00:1 Os01t0372866-00:1 Os01t0372700-01:1 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.498489103 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
15358110-15358160(-) 15358070-15358160(-) |
Potential amino acid sequence |
MRLNDDQKTVAAMDVLVPKVFNRGDI*(-) MFLCPRYLTEVIFKKPVIVYNYPKEIKAFYMRLNDDQKTVAAMDVLVPKVFNRGDI*(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Ye et al., 2015;Chu et al., 2017 |