Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os01g0372866_circ_g.1 |
| ID in PlantcircBase | osa_circ_001747 |
| Alias | Os_ciR2561 |
| Organism | Oryza sativa |
| Position | chr1: 15358052-15358181 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer, find_circ |
| Parent gene | Os01g0372700 |
| Parent gene annotation |
Similar to Asparaginyl-tRNA synthetase, cytoplasmic 1 (EC 6.1.1. 22) (Asparagine-- tRNA ligase 1) (AsnRS 1). (Os01t0372700-01) |
| Parent gene strand | - |
| Alternative splicing | NA |
| Support reads | 6/1 |
| Tissues | root/shoot, root |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Os01t0372866-00:1 Os01t0372866-00:1 Os01t0372700-01:1 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.498489103 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
15358110-15358160(-) 15358070-15358160(-) |
| Potential amino acid sequence |
MRLNDDQKTVAAMDVLVPKVFNRGDI*(-) MFLCPRYLTEVIFKKPVIVYNYPKEIKAFYMRLNDDQKTVAAMDVLVPKVFNRGDI*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Ye et al., 2015;Chu et al., 2017 |