Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Solyc07g065080.2_circ_g.1 |
| ID in PlantcircBase | sly_circ_002429 |
| Alias | NA |
| Organism | Solanum lycopersicum |
| Position | chr7: 66987672-66992473 JBrowse» |
| Reference genome | SL2.50.38 |
| Type | ue-circRNA |
| Identification method | CIRI |
| Parent gene | Solyc07g065080.2 |
| Parent gene annotation |
protein_coding |
| Parent gene strand | - |
| Alternative splicing | Solyc07g065080.2_circ_g.2 |
| Support reads | 2 |
| Tissues | fruit |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Solyc07g065080.2.1:13 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.193161464 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
66987747-66992418(-) |
| Potential amino acid sequence |
MLPISSVLHGNLGVLSFCCLRISWSSTGNRGGKGDVFCWCYCF*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Zuo et al., 2016 |