Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os02g0117750_circ_g.1 |
ID in PlantcircBase | osa_circ_012770 |
Alias | NA |
Organism | Oryza sativa |
Position | chr2: 926637-926708 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | e-circRNA |
Identification method | PcircRNA_finder |
Parent gene | Os02g0117700 |
Parent gene annotation |
UDPase (Os02t0117700-01) |
Parent gene strand | - |
Alternative splicing | NA |
Support reads | 1 |
Tissues | anther |
Exon boundary | Yes-Yes |
Splicing signals | CT-AC |
Number of exons covered | Os02t0117750-00:1 Os02t0117750-00:1 Os02t0117700-01:1 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.299769444 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
926696-926705(+) |
Potential amino acid sequence |
MVTLPLFSITAPSGISSLTPGWAVMVTLPLFSITAPSGISSLTPGWAVMVTLPLFSITAPSGIS SLTPGWAVMVTL(+) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Chu et al., 2017 |