Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Solyc06g073960.2_circ_g.1 |
| ID in PlantcircBase | sly_circ_002082 |
| Alias | 6:42097459|42097658 |
| Organism | Solanum lycopersicum |
| Position | chr6: 45707559-45707758 JBrowse» |
| Reference genome | SL2.50.38 |
| Type | e-circRNA |
| Identification method | CIRI |
| Parent gene | Solyc06g073960.2 |
| Parent gene annotation |
Serine/threonine-protein phosphatase |
| Parent gene strand | - |
| Alternative splicing | NA |
| Support reads | 3 |
| Tissues | fruit |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Solyc06g073960.2.1:1 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.678759917 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
45707730-45707633(+) 45707667-45707688(-) |
| Potential amino acid sequence |
MPSPNSISLTHNKSIRTIEPASIAIGRWIFSICST*(+) MHGGIGRSINHVEQIENIQRPIAMDAGSIVLMDLLWVSEMEFGLGIDLTGCSTGFLWQH*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | fruit ripening |
| Other Information | |
|---|---|
| References | Yin et al., 2018 |