Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os05g0176100_circ_g.5 |
| ID in PlantcircBase | osa_circ_026842 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr5: 4566531-4567220 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer |
| Parent gene | Os05g0176100 |
| Parent gene annotation |
Similar to Cellulose synthase BoCesA1. (Os05t0176100-01);Similar to RSW1-like cellulose synthase catalytic subunit (Fragment). ( Os05t0176100-05);Similar to Cellulose synthase BoCesA1. (Os05t01 76100-06);Similar to Cellulose synthase BoCesA8. (Os05t0176100-0 7) |
| Parent gene strand | - |
| Alternative splicing | NA |
| Support reads | 1 |
| Tissues | root |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Os05t0176100-07:1 Os05t0176100-05:2 Os05t0176100-06:2 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.531782923 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
4567196-4567196(-) |
| Potential amino acid sequence |
MSQKRLEKRFGQSPIFIASTFMTQGGIPPSTNPASLLKEAIHVISCGYEDKTEWGKEIGWIYGS VTEDILTGFKMHARGWISIYCMPPRPCFKGSAPINLSDRLNQVLRWALGSVEILLSRHCPIWYG YNGRLKLLERLAYINTIVYPITSIPLIAYCVLPAICLLTNKFIIPEVMKMKGQC*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |