Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os03g0352300_circ_g.3 |
| ID in PlantcircBase | osa_circ_019830 |
| Alias | Os_ciR8505 |
| Organism | Oryza sativa |
| Position | chr3: 13223197-13223349 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer, find_circ |
| Parent gene | Os03g0352300 |
| Parent gene annotation |
Similar to Nucleolar protein. (Os03t0352300-01);Similar to nucle olar protein Nop56. (Os03t0352300-02);Similar to nucleolar prote in Nop56. (Os03t0352300-03) |
| Parent gene strand | - |
| Alternative splicing | Os03g0352300_circ_g.2 |
| Support reads | 2/1 |
| Tissues | root/root |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Os03t0352300-01:1 Os03t0352300-02:1 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.453552124 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
13223222-13223295(-) 13223250-13223199(-) |
| Potential amino acid sequence |
MMPQMMLMSQLPQSLGKSFVSKLRSG*(-) MKAAIDSMVNDATNDVDESATAVFGQKLREQVEERLDFYDKGVAPRKNLDVMKAAIDSMVNDAT NDVDESATAVFGQKLREQVEERLDFYDKGVAPRKNLDVMKAAIDSMVNDATNDVDESATAVFGQ KLREQVEERLDFYDKGVAPRKNLDVMKAAIDSMVNDATNDVD(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Ye et al., 2015;Chu et al., 2017 |