Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os03g0805400_circ_g.2 |
| ID in PlantcircBase | osa_circ_022351 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr3: 33628976-33629563 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer |
| Parent gene | Os03g0805400 |
| Parent gene annotation |
Phosphatidic acid phosphatase type 2/haloperoxidase domain conta ining protein. (Os03t0805400-01);Phosphatidic acid phosphatase t ype 2/haloperoxidase domain containing protein. (Os03t0805400-02 );Similar to phosphoric ester hydrolase. (Os03t0805400-03) |
| Parent gene strand | - |
| Alternative splicing | Os03g0805400_circ_g.3 |
| Support reads | 1 |
| Tissues | shoot |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Os03t0805400-01:3 Os03t0805400-02:3 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.167178245 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
33629519-33629007(+) 33629556-33629212(+) 33629243-33629240(-) |
| Potential amino acid sequence |
MTAQRRNCPATCDAPSHQTNGIKSVR*(+) MHLPIKQTVLRACDEGNPYSMAFSFSSSVAVTLLTGGELGRGADTASFTELPR*(+) MTLLMAFCDYLGNSVKDAVSAPRPSSPPVRRVTATEDEKENAMEYGLPSSHALNTVCLMGRCIT SCWTVSSLCCHALSLSLSTPDSSLSSSGADTPSWLGR*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |