Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Zm00001d032637_circ_g.1 |
ID in PlantcircBase | zma_circ_006812 |
Alias | zma_circ_0000432 |
Organism | Zea mays |
Position | chr1: 232686060-232688164 JBrowse» |
Reference genome | AGPv4.38 |
Type | u-circRNA |
Identification method | find_circ |
Parent gene | Zm00001d032637 |
Parent gene annotation |
myosin1 |
Parent gene strand | - |
Alternative splicing | NA |
Support reads | NA |
Tissues | leaf, root |
Exon boundary | Yes-Yes |
Splicing signals | CT-AC |
Number of exons covered | Zm00001d032637_T013:4 Zm00001d032637_T006:4 Zm00001d032637_T008:4 Zm00001d032637_T001:3 Zm00001d032637_T021:4 Zm00001d032637_T027:4 Zm00001d032637_T029:4 Zm00001d032637_T020:4 Zm00001d032637_T018:4 Zm00001d032637_T017:4 Zm00001d032637_T004:4 Zm00001d032637_T015:3 Zm00001d032637_T012:5 Zm00001d032637_T025:4 Zm00001d032637_T002:3 Zm00001d032637_T023:5 Zm00001d032637_T026:3 Zm00001d032637_T031:4 Zm00001d032637_T009:4 Zm00001d032637_T033:1 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.076685218 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
232686192-232688103(-) |
Potential amino acid sequence |
MRNLLSRMPQILLLQTSLSNILTRILASEEKEARHLLSVTMQERQLTQEMLWPNQCMPVCLSGL *(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Ma et al., 2021b |