Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os08g0521400_circ_g.2 |
| ID in PlantcircBase | osa_circ_037738 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr8: 25940095-25940246 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer |
| Parent gene | Os08g0521400 |
| Parent gene annotation |
Similar to Zn-finger, RanBP-type, containing protein. (Os08t0521 400-01);Similar to Zn-finger, RanBP-type, containing protein. (O s08t0521400-02);Zinc finger, RanBP2-type domain containing prote in. (Os08t0521400-03) |
| Parent gene strand | + |
| Alternative splicing | NA |
| Support reads | 1 |
| Tissues | shoot |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Os08t0521400-01:1 Os08t0521400-02:1 Os08t0521400-03:1 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.347949452 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
25940104-25940142(+) 25940145-25940217(-) 25940201-25940225(-) |
| Potential amino acid sequence |
MPEGSWKCEKCNNINYPFRTKCNRPSCEAEKPFQTNNANESSADQDNQNQRCQKVVGSARSAIT *(+) MLLHFSHFQLPSGIFGSDCPDQQMTH*(-) MAFQPRNLDGYILCGMDSLCYCTSRTSNYLLASLVLIVLISR*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |