Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os12g0133800_circ_g.2 |
ID in PlantcircBase | osa_circ_010437 |
Alias | NA |
Organism | Oryza sativa |
Position | chr12: 1659091-1659789 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | e-circRNA |
Identification method | CIRCexplorer |
Parent gene | Os12g0133800 |
Parent gene annotation |
Similar to Auxin efflux carrier. (Os12t0133800-01) |
Parent gene strand | - |
Alternative splicing | Os12g0133800_circ_g.1 |
Support reads | 2 |
Tissues | root |
Exon boundary | Yes-Yes |
Splicing signals | CT-AC |
Number of exons covered | Os12t0133850-00:2 Os12t0133850-00:2 Os12t0133800-01:3 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.202857213 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
1659193-1659776(-) 1659660-1659642(-) |
Potential amino acid sequence |
MPWPSGSSLVLPSWLRPPSPSDFAGCFCTLPLFRCSGL*(-) MPPASVMTRLILIMVWRKLIRNPNTYSSLLGVIWSLVSYRWGIEMPAIIARSISILSDAGLGMA MFSLGLFMALQPRIIACGNSLASYAMAVRFLVGPAVMAAASIAVGLRGVLLHIAIVQVLRPMMS TASGTRMRRTGRHCRSWGPTRRRSSGQRTTARGGRQRCRRRA*(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Chu et al., 2017 |