Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | BGIOSGA007976_circ_g.5 |
ID in PlantcircBase | osi_circ_003824 |
Alias | 2:11426108|11427015 |
Organism | Oryza sativa ssp. indica |
Position | chr2: 11426108-11427015 JBrowse» |
Reference genome | Oryza_indica.ASM465v1.42 |
Type | e-circRNA |
Identification method | find_circ |
Parent gene | BGIOSGA007976 |
Parent gene annotation | NA |
Parent gene strand | + |
Alternative splicing | BGIOSGA007976_circ_g.1 BGIOSGA007976_circ_g.2 BGIOSGA007976_circ_g.3 BGIOSGA007976_circ_g.4 |
Support reads | NA |
Tissues | leaf |
Exon boundary | Yes-Yes |
Splicing signals | GT-AG |
Number of exons covered | BGIOSGA007976-TA:5 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
11426422-11426940(-) 11426741-11426169(+) |
Potential amino acid sequence |
MSVKLEIFARLSGIDPLKLLSLSINNWSLESWPREAGISPTKRLSSKSKLVKLERLPNCSGMPP EILLPAKDLLHPQKLPADGFSSSLYRTEREQLQ*(-) MSYQSGSHSSKIGIVLGTVGGVIGLLIVAALFLFCKGRRKSHLREVFVDVAGPWLVIGFPVAYQ SNLVIFLV*(+) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Huang et al., 2021 |