Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Solyc11g005130.1_circ_g.1 |
ID in PlantcircBase | sly_circ_003231 |
Alias | NA |
Organism | Solanum lycopersicum |
Position | chr11: 119413-119977 JBrowse» |
Reference genome | SL2.50.38 |
Type | e-circRNA |
Identification method | Segemehl, CIRI |
Parent gene | Solyc11g005130.1 |
Parent gene annotation |
protein_coding |
Parent gene strand | - |
Alternative splicing | Solyc11g005130.1_circ_g.2 |
Support reads | NA |
Tissues | fruit |
Exon boundary | Yes-Yes |
Splicing signals | CT-AC |
Number of exons covered | Solyc11g005130.1.1:1 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.748396761 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
119467-119977(-) |
Potential amino acid sequence |
MRSLMSVALRERTQVRLCEPVSPKNQQPKKRRRKDLAKSHVGDDDGHNPSKPVKVGKKAGKLVP VVSETSHPSHGVALQNVSHEEKFPNQLNVSEIPTTKKAADTQDMSELSPSASLRGNSAEEKDLD QQKIGVTQSKNLGDKLKDGSEISGKSSQRLHDRSSYAQEKSNVGRSVNISDGIDQSVQRRDEKF NVSGFEGKNSGQTM*(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Tan et al., 2017 |