Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Solyc01g079500.2_circ_g.1 |
| ID in PlantcircBase | sly_circ_000176 |
| Alias | 1:71060936|71061559 |
| Organism | Solanum lycopersicum |
| Position | chr1: 78550130-78550753 JBrowse» |
| Reference genome | SL2.50.38 |
| Type | e-circRNA |
| Identification method | CIRI |
| Parent gene | Solyc01g079500.2 |
| Parent gene annotation |
DNA replication licensing factor MCM7 |
| Parent gene strand | + |
| Alternative splicing | NA |
| Support reads | 5 |
| Tissues | fruit |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Solyc01g079500.2.1:3 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.259346888 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
78550200-78550717(-) |
| Potential amino acid sequence |
MYEALTSLIVKGRPFEDALTYTSLPCKFSSEVHSH*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | fruit ripening |
| Other Information | |
|---|---|
| References | Yin et al., 2018 |