Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Zm00001d037950_circ_g.3 |
ID in PlantcircBase | zma_circ_009081 |
Alias | Zm06circ00073, GRMZM2G349554_C1 |
Organism | Zea mays |
Position | chr6: 143322502-143323050 JBrowse» |
Reference genome | AGPv4.38 |
Type | ue-circRNA |
Identification method | CIRI2 |
Parent gene | Zm00001d037950 |
Parent gene annotation |
Serine/threonine-protein kinase TOR |
Parent gene strand | - |
Alternative splicing | NA |
Support reads | NA |
Tissues | leaf, endosperm |
Exon boundary | Yes-Yes |
Splicing signals | CT-AC |
Number of exons covered | Zm00001d037950_T017:3 Zm00001d037950_T001:3 Zm00001d037950_T020:3 Zm00001d037950_T004:3 Zm00001d037950_T007:3 Zm00001d037950_T008:3 Zm00001d037950_T002:3 Zm00001d037950_T019:3 Zm00001d037950_T006:3 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.325483572 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
143323001-143323022(-) |
Potential amino acid sequence |
MYLLHILPSCIQVLGDAERCNDYYYVPDILHTLEVFGGNLDEHMHLVAPVLVRLFKVELVDIRR RAIVTLTNLIPKVQVFVSNTHCVYFTCPEQVGTHVSALVHHLKLVLDGFFTLSSSYA*(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | responsive to drought stress |
Other Information | |
---|---|
References | Han et al., 2020;Zhang et al., 2019 |