Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Zm00001d015999_circ_g.4 |
| ID in PlantcircBase | zma_circ_008668 |
| Alias | zma_circ_0001878, GRMZM2G418206_C1 |
| Organism | Zea mays |
| Position | chr5: 138471713-138472088 JBrowse» |
| Reference genome | AGPv4.38 |
| Type | e-circRNA |
| Identification method | find_circ, CIRI2 |
| Parent gene | Zm00001d015999 |
| Parent gene annotation |
drug transmembrane transporters;antiporters |
| Parent gene strand | + |
| Alternative splicing | Zm00001d015999_circ_g.2 Zm00001d015999_circ_g.3 Zm00001d015999_circ_g.5 |
| Support reads | NA |
| Tissues | leaf, root |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Zm00001d015999_T001:2 Zm00001d015999_T002:1 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.177199231 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
138472014-138471720(+) 138472003-138472069(-) 138471732-138472019(-) |
| Potential amino acid sequence |
MITSWYKSGSKKIQYMQPLLVQMMIEMA*(+) MRSPMRCLLCKTIKGHFFDVNLSLIASATELTLLKERCLWLNRPTLAASTTASKGPCFSSHFNH HLNQ*(-) MLFKPFQSSFEPVGVAYIEFSCFHFCTNL*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | responsive to drought stress |
| Other Information | |
|---|---|
| References | Ma et al., 2021b;Zhang et al., 2019 |