Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os10g0382300_circ_g.3 |
ID in PlantcircBase | osa_circ_006679 |
Alias | Os_ciR6692 |
Organism | Oryza sativa |
Position | chr10: 12333618-12333723 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | e-circRNA |
Identification method | CIRCexplorer, find_circ |
Parent gene | Os10g0382300 |
Parent gene annotation |
Similar to Signal peptide containing large protein with proline stretches. (Os10t0382300-01);Similar to Signal peptide containin g large protein with proline stretches. (Os10t0382300-02) |
Parent gene strand | + |
Alternative splicing | Os10g0382300_circ_g.1 Os10g0382300_circ_g.2 |
Support reads | 2/1 |
Tissues | root/shoot, root |
Exon boundary | Yes-Yes |
Splicing signals | GT-AG |
Number of exons covered | Os10t0382300-02:1 Os10t0382300-01:1 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.300315881 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
12333634-12333619(+) 12333713-12333619(+) 12333715-12333666(-) |
Potential amino acid sequence |
MKLDLPLLDKLIHEYCIYRGIVEGGSHVLPE*(+) MSFLNELCRMKLDLPLLDKLIHEYCIYRGIVEGGSHVLPE*(+) MGTTFNYSPVYTVLVYKFIQKWQIQLHSAQFIQEGHGNHLQLFPCIYSTRV*(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Ye et al., 2015;Chu et al., 2017 |