Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Zm00001d031817_circ_g.2 |
| ID in PlantcircBase | zma_circ_006730 |
| Alias | Zm01circ00122, GRMZM2G082640_C1 |
| Organism | Zea mays |
| Position | chr1: 202888762-202889294 JBrowse» |
| Reference genome | AGPv4.38 |
| Type | e-circRNA |
| Identification method | CIRI2 |
| Parent gene | Zm00001d031817 |
| Parent gene annotation |
PWWP domain protein |
| Parent gene strand | + |
| Alternative splicing | Zm00001d031817_circ_g.1 |
| Support reads | NA |
| Tissues | leaf, endosperm |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Zm00001d031817_T006:4 Zm00001d031817_T002:4 Zm00001d031817_T005:4 Zm00001d031817_T003:4 Zm00001d031817_T004:4 Zm00001d031817_T007:4 Zm00001d031817_T001:4 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.04033707 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
202888985-202888766(+) 202889257-202888766(+) |
| Potential amino acid sequence |
MMLKQENKSAMEAFREVLEKELSGVNLRSDYEDGYEEEDVNSKGH*(+) MRMVMKRKMSTQKVIDESCVGSKPKKKDKYDCLVRLYGTCQYLYVDPWKSNSEFEMMLKQENKS AMEAFREVLEKELSGVNLRSDYEDGYEEEDVNSKGH*(+) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Han et al., 2020;Zhang et al., 2019 |