Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Zm00001d031817_circ_g.2 |
ID in PlantcircBase | zma_circ_006730 |
Alias | Zm01circ00122, GRMZM2G082640_C1 |
Organism | Zea mays |
Position | chr1: 202888762-202889294 JBrowse» |
Reference genome | AGPv4.38 |
Type | e-circRNA |
Identification method | CIRI2 |
Parent gene | Zm00001d031817 |
Parent gene annotation |
PWWP domain protein |
Parent gene strand | + |
Alternative splicing | Zm00001d031817_circ_g.1 |
Support reads | NA |
Tissues | leaf, endosperm |
Exon boundary | Yes-Yes |
Splicing signals | GT-AG |
Number of exons covered | Zm00001d031817_T006:4 Zm00001d031817_T002:4 Zm00001d031817_T005:4 Zm00001d031817_T003:4 Zm00001d031817_T004:4 Zm00001d031817_T007:4 Zm00001d031817_T001:4 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.04033707 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
202888985-202888766(+) 202889257-202888766(+) |
Potential amino acid sequence |
MMLKQENKSAMEAFREVLEKELSGVNLRSDYEDGYEEEDVNSKGH*(+) MRMVMKRKMSTQKVIDESCVGSKPKKKDKYDCLVRLYGTCQYLYVDPWKSNSEFEMMLKQENKS AMEAFREVLEKELSGVNLRSDYEDGYEEEDVNSKGH*(+) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Han et al., 2020;Zhang et al., 2019 |