Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Zm00001d014640_circ_g.2 |
ID in PlantcircBase | zma_circ_008491 |
Alias | zma_circ_0002122, GRMZM2G162184_C1 |
Organism | Zea mays |
Position | chr5: 56927374-56927765 JBrowse» |
Reference genome | AGPv4.38 |
Type | u-circRNA |
Identification method | find_circ, CIRI2 |
Parent gene | Zm00001d014640 |
Parent gene annotation |
E3 ubiquitin-protein ligase BRE1-like 1 |
Parent gene strand | + |
Alternative splicing | Zm00001d014640_circ_g.1 |
Support reads | NA |
Tissues | leaf, root |
Exon boundary | Yes-Yes |
Splicing signals | GT-AG |
Number of exons covered | Zm00001d014640_T002:2 Zm00001d014640_T027:2 Zm00001d014640_T030:2 Zm00001d014640_T033:1 Zm00001d014640_T014:1 Zm00001d014640_T019:2 Zm00001d014640_T020:2 Zm00001d014640_T034:1 Zm00001d014640_T029:2 Zm00001d014640_T009:2 Zm00001d014640_T018:2 Zm00001d014640_T012:2 Zm00001d014640_T011:2 Zm00001d014640_T004:2 Zm00001d014640_T006:2 Zm00001d014640_T035:1 Zm00001d014640_T007:2 Zm00001d014640_T010:2 Zm00001d014640_T013:1 Zm00001d014640_T005:2 Zm00001d014640_T003:2 Zm00001d014640_T036:1 Zm00001d014640_T008:2 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.104924131 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
56927713-56927382(+) 56927654-56927717(-) |
Potential amino acid sequence |
MSTCLHVQDPRNIAMSRPIKL*(+) MNSWSANKICFQPVPIFKRRATCLRLGTTIHHPPGQHCLNHVVIGCWDVEWQYLEFDRTRHSNV SGILHVEAS*(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | responsive to drought stress |
Other Information | |
---|---|
References | Ma et al., 2021b;Zhang et al., 2019 |