Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os03g0336700_circ_g.2 |
ID in PlantcircBase | osa_circ_019691 |
Alias | NA |
Organism | Oryza sativa |
Position | chr3: 12495988-12496641 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | e-circRNA |
Identification method | CIRCexplorer |
Parent gene | Os03g0336700 |
Parent gene annotation |
PAP/25A core domain containing protein. (Os03t0336700-01);Hypoth etical conserved gene. (Os03t0336700-02) |
Parent gene strand | + |
Alternative splicing | Os03g0336700_circ_g.1 |
Support reads | 1 |
Tissues | shoot |
Exon boundary | Yes-Yes |
Splicing signals | GT-AG |
Number of exons covered | Os03t0336700-01:3 |
Conservation Information | |
---|---|
Conserved circRNAs | osi_circ_004798* |
PMCS | 0.298150612 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
12496016-12496551(-) |
Potential amino acid sequence |
MIFSNFTVNLCSHFCQDCCVPLVDQLCSDILNGTQYCMH*(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Chu et al., 2017 |