Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | AT5G14520_circ_g.8 |
ID in PlantcircBase | ath_circ_038247 |
Alias | NA |
Organism | Arabidpsis thaliana |
Position | chr5: 4683582-4683830 JBrowse» |
Reference genome | TAIR10.38 |
Type | e-circRNA |
Identification method | KNIFE, PcircRNA_finder, circRNA_finder, find_circ |
Parent gene | AT5G14520 |
Parent gene annotation |
Pescadillo homolog |
Parent gene strand | - |
Alternative splicing | AT5G14520_circ_g.4 AT5G14520_circ_g.5 AT5G14520_circ_g.6 AT5G14520_circ_g.7 |
Support reads | 17 |
Tissues | whole_plant |
Exon boundary | Yes-Yes |
Splicing signals | CT-AC |
Number of exons covered | AT5G14520.1:1 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.20186322 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
4683731-4683584(-) |
Potential amino acid sequence |
MHEPLLEKFREIKTYQKKVKKAKAKKNEELARLLLTRQPTYKLDRLIRERRLCIVKGIFPREPK KKIKGNHHTYYHVKDIAFLMHEPLLEKFREIKTYQKKVKKAKAKKNEELARLLLTRQPTYKLDR LIRERRLCIVKGIFPREPKKKIKGNHHTYYHVKDIAFLMHEPLLEKFREIKTYQKKVKKAKAKK NEELARLLLTRQPTYKLDRLIRERRLCIVKGIFPREPKKKIKGNHHTYYHVKDIAFLMHEPLLE KFREIKTYQKKVKKAKAKKNEELARLLLTRQPTYKLDRLIRE(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Chu et al., 2017 |