Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os01g0242600_circ_g.2 |
| ID in PlantcircBase | osa_circ_001021 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr1: 7863718-7864070 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer |
| Parent gene | Os01g0242600 |
| Parent gene annotation |
C2 calcium-dependent membrane targeting domain containing protei n. (Os01t0242600-01);C2 calcium-dependent membrane targeting dom ain containing protein. (Os01t0242600-02) |
| Parent gene strand | - |
| Alternative splicing | Os01g0242600_circ_g.3 Os01g0242600_circ_g.4 |
| Support reads | 1 |
| Tissues | root |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Os01t0242600-02:2 Os01t0242600-01:2 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.310262417 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
7863996-7863773(+) 7863774-7864066(-) 7863998-7864066(-) |
| Potential amino acid sequence |
MSDPSKISSFTYATGGLSSMLNQSLSKRVIKHVVLITHFHGKFI*(+) MNLPWKCVIRTTCLMTRLDNDWFSIEERPPVAYVKLEILEGSDMKPSDMNGLSDPYVKGRLGPF KFQTQIQKKTLSPKWFEEFKIPITSWESLNELAMEVCDKDHMFDDSLGQ*(-) MKPSDMNGLSDPYVKGRLGPFKFQTQIQKKTLSPKWFEEFKIPITSWESLNELAMEVCDKDHMF DDSLGQ*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |