Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | AT4G37080_circ_g.2 |
ID in PlantcircBase | ath_circ_035165 |
Alias | NA |
Organism | Arabidpsis thaliana |
Position | chr4: 17474238-17474549 JBrowse» |
Reference genome | TAIR10.38 |
Type | e-circRNA |
Identification method | CIRCexplorer, CIRI-full |
Parent gene | AT4G37080 |
Parent gene annotation |
Protein of unknown function, DUF547 |
Parent gene strand | + |
Alternative splicing | AT4G37080_circ_g.1 AT4G37080_circ_g.3 AT4G37080_circ_g.4 AT4G37080_circ_g.5 AT4G37080_circ_g.6 AT4G37080_circ_g.7 AT4G37080_circ_g.8 |
Support reads | 1 |
Tissues | root |
Exon boundary | Yes-Yes |
Splicing signals | GT-AG |
Number of exons covered | AT4G37080.3:2 AT4G37080.1:2 AT4G37080.4:2 AT4G37080.2:2 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.326537927 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
17474253-17474546(+) |
Potential amino acid sequence |
MESQGNGAVANSGKSLVNRRRANKEKKMDLLQDVDKLKRKLRQEENVHRALERAFTRPLGALPR LPSYLPRHDEKKKMESQGNGAVANSGKSLVNRRRANKEKKMDLLQDVDKLKRKLRQEENVHRAL ERAFTRPLGALPRLPSYLPRHDEKKKMESQGNGAVANSGKSLVNRRRANKEKKMDLLQDVDKLK RKLRQEENVHRALERAFTRPLGALPRLPSYLPRHDEKKKMESQGNGAVANSGKSLVNRRRANKE KKMDLLQDVDKLKRKLRQEENVHRALERAFTRPLGALPRLPSYLPRH(+) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Chu et al., 2017 |