Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | BGIOSGA026047_circ_g.2 |
ID in PlantcircBase | osi_circ_007303 |
Alias | 7:22087831|22088159 |
Organism | Oryza sativa ssp. indica |
Position | chr7: 22087831-22088159 JBrowse» |
Reference genome | Oryza_indica.ASM465v1.42 |
Type | e-circRNA |
Identification method | find_circ |
Parent gene | BGIOSGA026047 |
Parent gene annotation | NA |
Parent gene strand | + |
Alternative splicing | NA |
Support reads | NA |
Tissues | leaf |
Exon boundary | Yes-Yes |
Splicing signals | GT-AG |
Number of exons covered | BGIOSGA026047-TA:1 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
22087846-22087978(-) 22088125-22087995(+) |
Potential amino acid sequence |
MIPKTCFPNFLLMSSLIFSTAYTEQARISTSSSLPGTISLLESIEQDKLEPYFSMPSSLKTAGT I*(-) MRELINKKFGKQVFGIIHFTKDTRFSCIRELRYLLLICGVLLRDKTMGSSTTSSPSPYLQTILF LLS*(+) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Huang et al., 2021 |