Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os09g0322200_circ_g.1 |
| ID in PlantcircBase | osa_circ_038844 |
| Alias | Os09circ02567 |
| Organism | Oryza sativa |
| Position | chr9: 9381638-9382304 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | ue-circRNA |
| Identification method | CIRCexplorer, SMALT, Segemehl |
| Parent gene | Os09g0322200 |
| Parent gene annotation |
Similar to Nudix hydrolase 24. (Os09t0322200-01) |
| Parent gene strand | - |
| Alternative splicing | Os09g0322200_circ_g.2 Os09g0322200_circ_g.3 |
| Support reads | 2/1 |
| Tissues | leaf/shoot |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Os09t0322200-01:2 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.297464293 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
9381657-9381699(+) 9382284-9381734(-) 9381746-9382294(-) |
| Potential amino acid sequence |
MIKHSWKGLLRITSLSNPKKFLALLLNIPIHMNSISQSRGQQHVPERSTQACHKMMLLDRAGHL QQDDQAFLERSASYHFS*(+) MACLCTSLWNVLLPPTLAYGVHMNGYVEKEGQKFLWIAKRSDTKQTFPGMLDHLVAGGLLYPIT SSYGMPVYFSLERAAAPYFGLWSSYEWVC*(-) MGMLRRRARNFFGLLREVIRSRPFQECLIILLQVACSIQ*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Lu et al., 2015;Chu et al., 2017 |