Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os01g0579900_circ_g.1 |
ID in PlantcircBase | osa_circ_002324 |
Alias | NA |
Organism | Oryza sativa |
Position | chr1: 22439407-22439864 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | e-circRNA |
Identification method | CIRCexplorer |
Parent gene | Os01g0579900 |
Parent gene annotation |
Esterase/lipase/thioesterase domain containing protein. (Os01t05 79900-01) |
Parent gene strand | - |
Alternative splicing | Os01g0579900_circ_ag.1 |
Support reads | 1 |
Tissues | root |
Exon boundary | Yes-Yes |
Splicing signals | CT-AC |
Number of exons covered | Os01t0579900-01:2 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.160481696 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
22439787-22439417(+) 22439797-22439493(+) 22439557-22439851(-) 22439831-22439846(-) |
Potential amino acid sequence |
MERHALCISVVNRSIKLSFVTLYKTFPHWM*(+) MLYAYQWSIVPSNSLLLPYIKPFLTGCNEIHHGIRKLFTVSSVAVICSLDDM*(+) MRSFLWKMHTNSRSIYRTTSYMSSREQITATLLTVKSFLMPWWISLHPVRKGFI*(-) MERLTTDMHKACLSISKECRFFTVHGSADEIIPVEDAYEFAKHIPNHKLHVIEGANHCYTAHRK ELSDAVVDFITSSEERFYIR*(-) |
Sponge-miRNAs | osa-miR396b-3p |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Chu et al., 2017 |