Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os01g0579900_circ_g.1 |
| ID in PlantcircBase | osa_circ_002324 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr1: 22439407-22439864 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer |
| Parent gene | Os01g0579900 |
| Parent gene annotation |
Esterase/lipase/thioesterase domain containing protein. (Os01t05 79900-01) |
| Parent gene strand | - |
| Alternative splicing | Os01g0579900_circ_ag.1 |
| Support reads | 1 |
| Tissues | root |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Os01t0579900-01:2 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.160481696 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
22439787-22439417(+) 22439797-22439493(+) 22439557-22439851(-) 22439831-22439846(-) |
| Potential amino acid sequence |
MERHALCISVVNRSIKLSFVTLYKTFPHWM*(+) MLYAYQWSIVPSNSLLLPYIKPFLTGCNEIHHGIRKLFTVSSVAVICSLDDM*(+) MRSFLWKMHTNSRSIYRTTSYMSSREQITATLLTVKSFLMPWWISLHPVRKGFI*(-) MERLTTDMHKACLSISKECRFFTVHGSADEIIPVEDAYEFAKHIPNHKLHVIEGANHCYTAHRK ELSDAVVDFITSSEERFYIR*(-) |
| Sponge-miRNAs | osa-miR396b-3p |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |