Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Zm00001d023583_circ_g.3 |
ID in PlantcircBase | zma_circ_010162 |
Alias | Zm10circ00011, GRMZM2G005848_C2 |
Organism | Zea mays |
Position | chr10: 10832943-10833582 JBrowse» |
Reference genome | AGPv4.38 |
Type | e-circRNA |
Identification method | CIRI2 |
Parent gene | Zm00001d023583 |
Parent gene annotation |
Dynamin-like protein ARC5 |
Parent gene strand | - |
Alternative splicing | Zm00001d023583_circ_g.2 |
Support reads | NA |
Tissues | leaf, endosperm |
Exon boundary | Yes-Yes |
Splicing signals | CT-AC |
Number of exons covered | Zm00001d023583_T002:3 Zm00001d023583_T005:3 Zm00001d023583_T001:3 Zm00001d023583_T003:3 Zm00001d023583_T004:3 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.155789109 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
10833534-10832982(+) 10833018-10832953(+) |
Potential amino acid sequence |
MAQTCHVLLPRQLHKQSFDDMIAQWIQQTS*(+) MATKVLTIFLQQINRDWDQPLQYVQKPKTQLIKEWLKRVTCFCHGNYTSSPLTT*(+) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | responsive to drought stress |
Other Information | |
---|---|
References | Han et al., 2020;Zhang et al., 2019 |