Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | AT3G27740_circ_g.3 |
| ID in PlantcircBase | ath_circ_024119 |
| Alias | Ath_circ_FC2201, Ath_circ_FC2202 |
| Organism | Arabidpsis thaliana |
| Position | chr3: 10282639-10283082 JBrowse» |
| Reference genome | TAIR10.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer |
| Parent gene | AT3G27740 |
| Parent gene annotation |
Carbamoyl-phosphate synthase small chain, chloroplastic |
| Parent gene strand | - |
| Alternative splicing | AT3G27740_circ_g.1 AT3G27740_circ_g.2 AT3G27740_circ_g.4 |
| Support reads | 1 |
| Tissues | root |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | AT3G27740.2:1 AT3G27740.1:3 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.157102442 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
10282886-10282641(-) |
| Potential amino acid sequence |
MGVYDLDTRAITRRLREDGSLIGVLSTEQSKTDDELLQMSRSWDIVDDEESGQCFLTGLVIRNL SISTSNWRCTKTLADYLTERDIMGVYDLDTRAITRRLREDGSLIGVLSTEQSKTDDELLQMSRS WDIVDDEESGQCFLTGLVIRNLSISTSNWRCTKTLADYLTERDIMGVYDLDTRAITRRLREDGS LIGVLSTEQSKTDDELLQMSRSWDIVDDEESGQCFLTGLVIRNLSISTSNWRCTKTLADYLTER DIMGVYDLDTRAITRRLREDGSLIGVLSTEQSKTDDELLQMSRSWDIV(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017;Chen et al., 2017a |