Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os06g0564500_circ_g.1 |
ID in PlantcircBase | osa_circ_031189 |
Alias | NA |
Organism | Oryza sativa |
Position | chr6: 21702712-21702839 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | e-circRNA |
Identification method | CIRCexplorer |
Parent gene | Os06g0564500 |
Parent gene annotation |
Cysteine synthase (EC 4.2.99.8). (Os06t0564500-01) |
Parent gene strand | - |
Alternative splicing | Os06g0564500_circ_ag.1 |
Support reads | 1 |
Tissues | shoot |
Exon boundary | Yes-Yes |
Splicing signals | CT-AC |
Number of exons covered | Os06t0564500-01:1 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.1996875 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
21702753-21702712(+) 21702814-21702838(-) |
Potential amino acid sequence |
MLPSSQPIEPVRLRSSRCSSSQQAVSIQSAEGTPVLDRAEWLVCFHLPNQSSLYAFVLRDVLHL NKRCPSNQLRALLSLTEQSGWYASIFPTNRACTPSFFAMFFISTSGVHPIS*(+) MKNIAKNEGVQARLVGKMEAYQPLCSVKDRSALS*(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Chu et al., 2017 |