Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os06g0564500_circ_g.1 |
| ID in PlantcircBase | osa_circ_031189 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr6: 21702712-21702839 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer |
| Parent gene | Os06g0564500 |
| Parent gene annotation |
Cysteine synthase (EC 4.2.99.8). (Os06t0564500-01) |
| Parent gene strand | - |
| Alternative splicing | Os06g0564500_circ_ag.1 |
| Support reads | 1 |
| Tissues | shoot |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Os06t0564500-01:1 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.1996875 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
21702753-21702712(+) 21702814-21702838(-) |
| Potential amino acid sequence |
MLPSSQPIEPVRLRSSRCSSSQQAVSIQSAEGTPVLDRAEWLVCFHLPNQSSLYAFVLRDVLHL NKRCPSNQLRALLSLTEQSGWYASIFPTNRACTPSFFAMFFISTSGVHPIS*(+) MKNIAKNEGVQARLVGKMEAYQPLCSVKDRSALS*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |