Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | orai.001G075800_circ_g.2 |
| ID in PlantcircBase | gra_circ_000042 |
| Alias | Chr01:7799909|7800686 |
| Organism | Gossypium raimondii |
| Position | chrChr01: 7799909-7800686 JBrowse» |
| Reference genome | Graimondii_221 |
| Type | e-circRNA |
| Identification method | CIRI |
| Parent gene | Gorai.001G075800 |
| Parent gene annotation | NA |
| Parent gene strand | - |
| Alternative splicing | orai.001G075800_circ_g.1 |
| Support reads | 129/8 |
| Tissues | leaf/ovule |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Gorai.001G075800.3:4 Gorai.001G075800.4:4 Gorai.001G075800.1:4 Gorai.001G075800.2:4 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | ghi_circ_000320* gar_circ_000091* ghi_circ_000100* |
| PMCS | 0.13072726 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
7800686-7800662(-) 7800273-7799940(+) |
| Potential amino acid sequence |
MERILERYERYSYAERQLAANENERTGSWTLEHAKLKARMEVLQRNQRHYMGEDLENLSLRELQ NLEHQLDSALKHIRSRKNQLMFESISELQKKHGEDPRTV*(-) MFQSPTTSSFIFICSKLPLCIRISFIPFEDPLHAFSEARKWIQT*(+) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Zhao et al., 2017b |