Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os02g0831550_circ_g.1 |
| ID in PlantcircBase | osa_circ_017371 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr2: 35758499-35758675 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | ei-circRNA |
| Identification method | CIRCexplorer |
| Parent gene | Os02g0831550 |
| Parent gene annotation |
Hypothetical protein. (Os02t0831550-00) |
| Parent gene strand | - |
| Alternative splicing | Os02g0831500_circ_g.1 Os02g0831550_circ_g.2 Os02g0831550_circ_g.3 Os02g0831550_circ_g.4 Os02g0831500_circ_g.5 |
| Support reads | 1 |
| Tissues | root |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Os02t0831500-01:1 Os02t0831500-01:1 Os02t0831550-00:1 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.301321516 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
35758609-35758499(+) 35758649-35758656(-) |
| Potential amino acid sequence |
MAKFFHSGSPGLTSILTWRDMPS*(+) MSNRETHCGRTLPSSVLNGTRRMLECFVFSIGSNSTLHLVPFASGMSLVSWAYLSR*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |