Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os01g0323000_circ_g.3 |
| ID in PlantcircBase | osa_circ_001563 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr1: 12329327-12331035 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer |
| Parent gene | Os01g0323000 |
| Parent gene annotation |
Similar to Ser Thr specific protein kinase-like protein. (Os01t0 323000-01);Similar to BRASSINOSTEROID INSENSITIVE 1-associated r eceptor kinase 1. (Os01t0323000-02) |
| Parent gene strand | + |
| Alternative splicing | Os01g0323000_circ_g.1 Os01g0323000_circ_g.2 |
| Support reads | 1 |
| Tissues | root |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Os01t0323000-01:3 Os01t0323000-02:3 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | osi_circ_009298 |
| PMCS | 0.28086831 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
12329485-12329341(+) 12331017-12329341(+) 12329344-12330925(-) |
| Potential amino acid sequence |
MGTFGYVAPEYANTGLLNEKSDIYSFGVVLLEAITGRDPVDYGRPANEVNLVDWLKMMVASRRS EEVVDPTIETRPSTRALKRALLTALRCVDPDSEKRPKMGQVVRMLESDDPIPRGACLLA*(+) MTQFLVGLAYLHEAIEPKVVHRDIKSSNILIDDDFDAKVSDFGLAKLLGAGKSHVTTRVMGTFG YVAPEYANTGLLNEKSDIYSFGVVLLEAITGRDPVDYGRPANEVNLVDWLKMMVASRRSEEVVD PTIETRPSTRALKRALLTALRCVDPDSEKRPKMGQVVRMLESDDPIPRGACLLA*(+) MQVSKPHEELGHPIPASSQLDPSLVSFLNLDPHISEQLKVHA*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |