Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os02g0137000_circ_g.6 |
| ID in PlantcircBase | osa_circ_013044 |
| Alias | Os_ciR7785 |
| Organism | Oryza sativa |
| Position | chr2: 1963015-1963304 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer, find_circ |
| Parent gene | Os02g0137000 |
| Parent gene annotation |
WD40 repeat-like domain containing protein. (Os02t0137000-01) |
| Parent gene strand | + |
| Alternative splicing | Os02g0137000_circ_g.7 |
| Support reads | 2/1 |
| Tissues | root/root |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Os02t0137000-01:1 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | osi_circ_011841 |
| PMCS | 0.505376839 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
1963288-1963059(+) 1963023-1963056(-) |
| Potential amino acid sequence |
MAKVAEGSFLMMGELNCIQLL*(+) MNPQQLSPYFQVQISPLKMMPCSMWRLAQNDNAHLILSPSRLIYLSIYPGNDEELEVAAARKVL LGYHQKLQQQMQTLHMFPYSQ*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Ye et al., 2015;Chu et al., 2017 |