Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os02g0137000_circ_g.6 |
ID in PlantcircBase | osa_circ_013044 |
Alias | Os_ciR7785 |
Organism | Oryza sativa |
Position | chr2: 1963015-1963304 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | e-circRNA |
Identification method | CIRCexplorer, find_circ |
Parent gene | Os02g0137000 |
Parent gene annotation |
WD40 repeat-like domain containing protein. (Os02t0137000-01) |
Parent gene strand | + |
Alternative splicing | Os02g0137000_circ_g.7 |
Support reads | 2/1 |
Tissues | root/root |
Exon boundary | Yes-Yes |
Splicing signals | GT-AG |
Number of exons covered | Os02t0137000-01:1 |
Conservation Information | |
---|---|
Conserved circRNAs | osi_circ_011841 |
PMCS | 0.505376839 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
1963288-1963059(+) 1963023-1963056(-) |
Potential amino acid sequence |
MAKVAEGSFLMMGELNCIQLL*(+) MNPQQLSPYFQVQISPLKMMPCSMWRLAQNDNAHLILSPSRLIYLSIYPGNDEELEVAAARKVL LGYHQKLQQQMQTLHMFPYSQ*(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Ye et al., 2015;Chu et al., 2017 |