Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os08g0144400_circ_g.5 |
ID in PlantcircBase | osa_circ_035840 |
Alias | Os_ciR11551 |
Organism | Oryza sativa |
Position | chr8: 2511892-2512369 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | e-circRNA |
Identification method | find_circ |
Parent gene | Os08g0144400 |
Parent gene annotation |
PDZ/DHR/GLGF domain containing protein. (Os08t0144400-01);Hypoth etical conserved gene. (Os08t0144400-02) |
Parent gene strand | - |
Alternative splicing | NA |
Support reads | 2 |
Tissues | root |
Exon boundary | Yes-Yes |
Splicing signals | CT-AC |
Number of exons covered | Os08t0144400-01:2 |
Conservation Information | |
---|---|
Conserved circRNAs | osi_circ_018024 |
PMCS | 0.217719229 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
2512359-2512188(-) |
Potential amino acid sequence |
MPNKTTTEGRLLFYNVHYGIALLEVMGDYKLEVPSFGSGTNYGQVIFALGRGENMSLMVSHGTI SWTDYPVLLRNHNMFLSCDIPEGGSGGPVVDHGGNMIGIAFVENPGPVFISIKTIMTCMEMWDQ FSYPSVCQIRQQQKEGCCSTMCTMVLLFWKSWETTSWRSLLLDRAQTTVRSYLHWVGVKTCL*( -) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Ye et al., 2015 |