Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os08g0144400_circ_g.5 |
| ID in PlantcircBase | osa_circ_035840 |
| Alias | Os_ciR11551 |
| Organism | Oryza sativa |
| Position | chr8: 2511892-2512369 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | find_circ |
| Parent gene | Os08g0144400 |
| Parent gene annotation |
PDZ/DHR/GLGF domain containing protein. (Os08t0144400-01);Hypoth etical conserved gene. (Os08t0144400-02) |
| Parent gene strand | - |
| Alternative splicing | NA |
| Support reads | 2 |
| Tissues | root |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Os08t0144400-01:2 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | osi_circ_018024 |
| PMCS | 0.217719229 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
2512359-2512188(-) |
| Potential amino acid sequence |
MPNKTTTEGRLLFYNVHYGIALLEVMGDYKLEVPSFGSGTNYGQVIFALGRGENMSLMVSHGTI SWTDYPVLLRNHNMFLSCDIPEGGSGGPVVDHGGNMIGIAFVENPGPVFISIKTIMTCMEMWDQ FSYPSVCQIRQQQKEGCCSTMCTMVLLFWKSWETTSWRSLLLDRAQTTVRSYLHWVGVKTCL*( -) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Ye et al., 2015 |