Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | AT1G63240_circ_g.1 |
| ID in PlantcircBase | ath_circ_008485 |
| Alias | AT1G63240_C1 |
| Organism | Arabidpsis thaliana |
| Position | chr1: 23457451-23457750 JBrowse» |
| Reference genome | TAIR10.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer, PcircRNA_finder, CIRI2 |
| Parent gene | AT1G63240 |
| Parent gene annotation |
Putative uncharacterized protein At1g63240 |
| Parent gene strand | - |
| Alternative splicing | AT1G63240_circ_g.2 AT1G63240_circ_g.3 AT1G63240_circ_g.4 AT1G63240_circ_g.5 |
| Support reads | 4 |
| Tissues | aerial, whole_plant, leaf |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | AT1G63240.1:2 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.449563492 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
23457751-23457453(-) |
| Potential amino acid sequence |
MNVNTSNDFNTNPKETVVLDENSMESEDSSGEVYETGCNEITYAIEEDEEDFSEREYVENVENF SNITSTPMNVNTSNDFNTNPKETVVLDENSMESEDSSGEVYETGCNEITYAIEEDEEDFSEREY VENVENFSNITSTPMNVNTSNDFNTNPKETVVLDENSMESEDSSGEVYETGCNEITYAIEEDEE DFSEREYVENVENFSNITSTPMNVNTSNDFNTNPKETVVLDENSMESEDSSGEVYETGCNEITY AIEEDEEDFSEREYVENVENFSNITSTP(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | response to drought stress |
| Other Information | |
|---|---|
| References | Chu et al., 2017;Zhang et al., 2019 |