Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os02g0177600_circ_g.1 |
ID in PlantcircBase | osa_circ_013452 |
Alias | Os_ciR1034 |
Organism | Oryza sativa |
Position | chr2: 4281752-4282415 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | e-circRNA |
Identification method | CIRCexplorer, find_circ |
Parent gene | Os02g0177600 |
Parent gene annotation |
4-coumarate:coenzyme A ligase, Lignin biosynthesis, Defense agai nst wounding (Os02t0177600-01) |
Parent gene strand | + |
Alternative splicing | Os02g0177633_circ_g.2 Os02g0177633_circ_g.3 |
Support reads | 17/5 |
Tissues | root/shoot, root |
Exon boundary | Yes-Yes |
Splicing signals | GT-AG |
Number of exons covered | Os02t0177600-01:2 |
Conservation Information | |
---|---|
Conserved circRNAs |
osi_circ_003692* osi_circ_012587 zma_circ_008622 zma_circ_002015 |
PMCS | 0.534835141 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
4281885-4281768(+) 4281827-4281802(-) |
Potential amino acid sequence |
MRKFDLGALVDLVRKHNITIAPFVPPIVVEIAKSPRVTAEDLASIRMVMSGAAPMGKDLQDAFM AKIPNAVLGQGYGMTEAGPVLAMCLAFAKEPFKVKSGSCGTVVRNAELKIVDPDTGTSLGRNQS GEICIRGEQIMKGGWREP*(+) MWNSGSRHSITSSLLKYRLGFSPSTFHDLFSADADLAGLVPAEGGAGVGVDDLQLRVAHHCTAR PGLNLEGLLGKRQAHCQHWPSLSHTVTLSEDGIGDLGHECILKVLPHGRGTGHDHADGGEVLRG DAGALGDLHHDGGHEGGDGDVVLAHKVDERAKIKLPHDHDGRPGTQASQQHGVERVDVEQWQQA *(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Ye et al., 2015;Chu et al., 2017 |