Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os02g0177600_circ_g.1 |
| ID in PlantcircBase | osa_circ_013452 |
| Alias | Os_ciR1034 |
| Organism | Oryza sativa |
| Position | chr2: 4281752-4282415 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer, find_circ |
| Parent gene | Os02g0177600 |
| Parent gene annotation |
4-coumarate:coenzyme A ligase, Lignin biosynthesis, Defense agai nst wounding (Os02t0177600-01) |
| Parent gene strand | + |
| Alternative splicing | Os02g0177633_circ_g.2 Os02g0177633_circ_g.3 |
| Support reads | 17/5 |
| Tissues | root/shoot, root |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Os02t0177600-01:2 |
| Conservation Information | |
|---|---|
| Conserved circRNAs |
osi_circ_003692* osi_circ_012587 zma_circ_008622 zma_circ_002015 |
| PMCS | 0.534835141 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
4281885-4281768(+) 4281827-4281802(-) |
| Potential amino acid sequence |
MRKFDLGALVDLVRKHNITIAPFVPPIVVEIAKSPRVTAEDLASIRMVMSGAAPMGKDLQDAFM AKIPNAVLGQGYGMTEAGPVLAMCLAFAKEPFKVKSGSCGTVVRNAELKIVDPDTGTSLGRNQS GEICIRGEQIMKGGWREP*(+) MWNSGSRHSITSSLLKYRLGFSPSTFHDLFSADADLAGLVPAEGGAGVGVDDLQLRVAHHCTAR PGLNLEGLLGKRQAHCQHWPSLSHTVTLSEDGIGDLGHECILKVLPHGRGTGHDHADGGEVLRG DAGALGDLHHDGGHEGGDGDVVLAHKVDERAKIKLPHDHDGRPGTQASQQHGVERVDVEQWQQA *(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Ye et al., 2015;Chu et al., 2017 |