Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | GLYMA_U017000_circ_g.2 |
| ID in PlantcircBase | gma_circ_007840 |
| Alias | gma-circRNA2848 |
| Organism | Glycine max |
| Position | chrscaffold_21: 2816000-2817243 JBrowse» |
| Reference genome | v2.0.38 |
| Type | e-circRNA |
| Identification method | find_circ |
| Parent gene | GLYMA_U017000 |
| Parent gene annotation |
hypothetical protein |
| Parent gene strand | - |
| Alternative splicing | GLYMA_U017000_circ_g.1 |
| Support reads | NA |
| Tissues | flower bud |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | KRG88970:2 KRG88971:2 KRG88972:2 KRG88974:2 KRG88975:2 KRG88973:2 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.181705935 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
2816041-2816000(+) 2816027-2817197(-) |
| Potential amino acid sequence |
MGPALTARGGLREIVGAGNHTSTKPVTMPVTTLATTKFSSLVNFSLRRSNSAAA*(+) MVVLIMLFRLLQNWSAVKKNSLRS*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | cytoplasmic male sterility |
| Other Information | |
|---|---|
| References | Chen et al., 2018 |