Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | AT5G23540_circ_g.2 |
| ID in PlantcircBase | ath_circ_040054 |
| Alias | AT5G23540_C1, AT5G23540_C1 |
| Organism | Arabidpsis thaliana |
| Position | chr5: 7938092-7938442 JBrowse» |
| Reference genome | TAIR10.38 |
| Type | ue-circRNA |
| Identification method | CIRI2 |
| Parent gene | AT5G23540 |
| Parent gene annotation |
26S proteasome non-ATPase regulatory subunit 14 homolog |
| Parent gene strand | + |
| Alternative splicing | AT5G23540_circ_g.1 AT5G23540_circ_g.3 |
| Support reads | NA |
| Tissues | leaf |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | AT5G23540.1:2 AT5G23540.2:2 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.511383896 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
7938147-7938146(+) 7938110-7938124(+) |
| Potential amino acid sequence |
MNTLLGLWMFLRCLRVVLVLVLKLLIMFSRLICSTCLNRPEDLRWWLVGIIHILDSAAGFLGLT LILNRKSWCSYGSHGIDAWRVCG* MEVMGLMLGEFVDEYTVRVVDVFAMPQSGTGVSVEAVDHVFQTNMLDMLKQTGRPEMVVGWYHS HPGFGCWLSGVDINTQQEELVFLWKSWD* |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | response to drought stress |
| Other Information | |
|---|---|
| References | Zhang et al., 2019 |