Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | AT1G48570_circ_g.1 |
ID in PlantcircBase | ath_circ_006340 |
Alias | Ath_circ_FC0703 |
Organism | Arabidpsis thaliana |
Position | chr1: 17955996-17956325 JBrowse» |
Reference genome | TAIR10.38 |
Type | e-circRNA |
Identification method | PcircRNA_finder |
Parent gene | AT1G48570 |
Parent gene annotation |
Putative uncharacterized protein At1g48570 |
Parent gene strand | - |
Alternative splicing | NA |
Support reads | 1 |
Tissues | whole_plant |
Exon boundary | Yes-Yes |
Splicing signals | CT-AC |
Number of exons covered | AT1G48570.1:2 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.257883165 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
17956043-17955998(-) |
Potential amino acid sequence |
MVNIVEMKKGDWNCTGCDFVNFARNERCRECNEVADRRPVAAVVKEGDWLCPECSFLNFTRNQS CLKCKAKGPKKTSMVNIVEMKKGDWNCTGCDFVNFARNERCRECNEVADRRPVAAVVKEGDWLC PECSFLNFTRNQSCLKCKAKGPKKTSMVNIVEMKKGDWNCTGCDFVNFARNERCRECNEVADRR PVAAVVKEGDWLCPECSFLNFTRNQSCLKCKAKGPKKTSMVNIVEMKKGDWNCT(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Chu et al., 2017;Chen et al., 2017a |