Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | AT1G48570_circ_g.1 |
| ID in PlantcircBase | ath_circ_006340 |
| Alias | Ath_circ_FC0703 |
| Organism | Arabidpsis thaliana |
| Position | chr1: 17955996-17956325 JBrowse» |
| Reference genome | TAIR10.38 |
| Type | e-circRNA |
| Identification method | PcircRNA_finder |
| Parent gene | AT1G48570 |
| Parent gene annotation |
Putative uncharacterized protein At1g48570 |
| Parent gene strand | - |
| Alternative splicing | NA |
| Support reads | 1 |
| Tissues | whole_plant |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | AT1G48570.1:2 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.257883165 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
17956043-17955998(-) |
| Potential amino acid sequence |
MVNIVEMKKGDWNCTGCDFVNFARNERCRECNEVADRRPVAAVVKEGDWLCPECSFLNFTRNQS CLKCKAKGPKKTSMVNIVEMKKGDWNCTGCDFVNFARNERCRECNEVADRRPVAAVVKEGDWLC PECSFLNFTRNQSCLKCKAKGPKKTSMVNIVEMKKGDWNCTGCDFVNFARNERCRECNEVADRR PVAAVVKEGDWLCPECSFLNFTRNQSCLKCKAKGPKKTSMVNIVEMKKGDWNCT(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017;Chen et al., 2017a |