Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os09g0506800_circ_g.2 |
| ID in PlantcircBase | osa_circ_039743 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr9: 19623829-19624968 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer, KNIFE, PcircRNA_finder |
| Parent gene | Os09g0506800 |
| Parent gene annotation |
Similar to Meiotic asynaptic mutant 1. (Os09t0506800-01);Similar to Essential protein for meiotic synapsis. (Os09t0506800-02) |
| Parent gene strand | + |
| Alternative splicing | Os09g0506800_circ_g.1 |
| Support reads | 1 |
| Tissues | seed |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Os09t0506800-01:4 Os09t0506800-02:4 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.1853878 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
19623832-19623831(+) |
| Potential amino acid sequence |
MKIKKLMPMDTESRRLIDWMEKGVYDALQKKYLKTLLFCICEKEEGPMIEEYAFSFSYPNTSGD EVAMNLSRTGSKKNSATFKSNAAEVTPDQMRSSACKMIRTLVSLMRTLDQMPEER*(+) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |