Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os09g0450300_circ_g.9 |
| ID in PlantcircBase | osa_circ_039385 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr9: 16858138-16859592 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer |
| Parent gene | Os09g0450300 |
| Parent gene annotation |
MAP65/ASE1 family protein. (Os09t0450300-01);MAP65/ASE1 family p rotein. (Os09t0450300-02);Microtubule-associated protein MAP65-1 a. (Os09t0450300-03) |
| Parent gene strand | - |
| Alternative splicing | Os09g0450300_circ_g.6 Os09g0450300_circ_g.7 Os09g0450300_circ_g.8 |
| Support reads | 1 |
| Tissues | root |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Os09t0450300-03:2 Os09t0450300-01:2 Os09t0450300-02:2 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.128073631 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
16858290-16858147(+) 16859431-16858178(+) 16858243-16859576(-) |
| Potential amino acid sequence |
MSENCLSLSSFLPFKFSSTGTTAASCSLSGTTLLSFFRYSLCSPRVATKDATSASLVATDWCSW TLVRLASSTFLRYTSKHSLSISDRTLFFSPSLSPTSAQICFSF*(+) MQLQLLWWPQTGAAGPWSDWHRPPSCGTLPSIPSRSLTEPCSSHLHFLLPLPRFAFLSEGREAV LGNC*(+) MAMIKQIVSSSMKMIYQQGSLTITKHSFTPFRKKSKSGQR*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |