Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | AT2G36850_circ_g.10 |
ID in PlantcircBase | ath_circ_016935 |
Alias | NA |
Organism | Arabidpsis thaliana |
Position | chr2: 15458838-15458957 JBrowse» |
Reference genome | TAIR10.38 |
Type | e-circRNA |
Identification method | PcircRNA_finder |
Parent gene | AT2G36850 |
Parent gene annotation |
Callose synthase 10 |
Parent gene strand | - |
Alternative splicing | AT2G36850_circ_g.4 AT2G36850_circ_g.5 AT2G36850_circ_g.6 AT2G36850_circ_g.7 AT2G36850_circ_g.8 AT2G36850_circ_g.9 |
Support reads | 3 |
Tissues | leaf |
Exon boundary | Yes-Yes |
Splicing signals | CT-AC |
Number of exons covered | AT2G36850.1:1 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.517931901 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
15458847-15458840(-) |
Potential amino acid sequence |
MNQEIYSIKLPGDPKLGEGKPENQNHAIVFTRGEAIQTIDMNQEIYSIKLPGDPKLGEGKPENQ NHAIVFTRGEAIQTIDMNQEIYSIKLPGDPKLGEGKPENQNHAIVFTRGEAIQTIDMNQ(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Chu et al., 2017 |