Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | AT5G60120_circ_g.4 |
ID in PlantcircBase | ath_circ_044928 |
Alias | AT5G60120_C1, AT5G60120_C1 |
Organism | Arabidpsis thaliana |
Position | chr5: 24209235-24209842 JBrowse» |
Reference genome | TAIR10.38 |
Type | e-circRNA |
Identification method | CIRI2 |
Parent gene | AT5G60120 |
Parent gene annotation |
Target of early activation tagged (EAT) 2 |
Parent gene strand | + |
Alternative splicing | AT5G60120_circ_g.1 AT5G60120_circ_g.2 AT5G60120_circ_g.3 AT5G60120_circ_g.5 |
Support reads | NA |
Tissues | leaf |
Exon boundary | Yes-Yes |
Splicing signals | GT-AG |
Number of exons covered | AT5G60120.4:2 AT5G60120.1:2 AT5G60120.2:2 AT5G60120.6:2 AT5G60120.3:2 AT5G60120.5:2 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.400968461 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
24209236-24209302(+) |
Potential amino acid sequence |
MANLSKEEVVQVLRRQSSGFSRNNSRYQGVALQKIGGWGAQMEQLHGNMGCDKAAVQWKGREAA SLIEPHASRMIPEADGESFQRGSCASTSATELWFLKE* |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | response to drought stress |
Other Information | |
---|---|
References | Zhang et al., 2019 |