Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Zm00001d049295_circ_g.2 |
ID in PlantcircBase | zma_circ_007990 |
Alias | zma_circ_0001761, GRMZM2G378580_C1 |
Organism | Zea mays |
Position | chr4: 24984754-24985650 JBrowse» |
Reference genome | AGPv4.38 |
Type | ue-circRNA |
Identification method | find_circ, CIRI2 |
Parent gene | Zm00001d049295 |
Parent gene annotation |
Auxin response factor 2 |
Parent gene strand | - |
Alternative splicing | Zm00001d049295_circ_g.1 |
Support reads | NA |
Tissues | leaf, root |
Exon boundary | Yes-Yes |
Splicing signals | CT-AC |
Number of exons covered | Zm00001d049295_T008:3 Zm00001d049295_T002:1 Zm00001d049295_T006:3 Zm00001d049295_T003:2 Zm00001d049295_T009:3 Zm00001d049295_T007:3 Zm00001d049295_T001:3 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.177828135 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
24985077-24984762(+) 24985649-24985646(-) 24984801-24985046(-) |
Potential amino acid sequence |
MPSWLTSEYVAKAPFHTMQVLGYKLLCWRLTGHILGL*(+) MTRQPPTQELVAKDLHGVEWRFRHIFRGQPRRHLLQSGWSVFVSAKRLVAGDAFIFLRGDSGEL RVGVRRAMRQQANVPSSVISSHSMHLGVLATAWHAVNTGTMFTVYYKPRI*(-) MLLTLGPCLLSTTSLGYDPSTSNTRACSQGPAWCGMALSPHIQRSTTKASFAEWLECFC*(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | responsive to drought stress |
Other Information | |
---|---|
References | Ma et al., 2021b;Zhang et al., 2019 |