Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os03g0121200_circ_g.1 |
ID in PlantcircBase | osa_circ_017646 |
Alias | NA |
Organism | Oryza sativa |
Position | chr3: 1175001-1175189 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | ei-circRNA |
Identification method | CIRCexplorer, KNIFE, PcircRNA_finder |
Parent gene | Os03g0121250 |
Parent gene annotation |
Hypothetical protein. (Os03t0121250-00) |
Parent gene strand | + |
Alternative splicing | NA |
Support reads | 17 |
Tissues | root, anther |
Exon boundary | Yes-Yes |
Splicing signals | CT-AC |
Number of exons covered | Os03t0121200-03:1 Os03t0121200-02:1 Os03t0121200-01:1 Os03t0121200-03:1 Os03t0121250-00:1 Os03t0121200-02:1 Os03t0121200-01:1 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.315826543 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
1175096-1175186(+) |
Potential amino acid sequence |
MTSKPRRLVFGGASFSALFPCVESSSTDASHPSARASRAAKARTSAQETTPKQAVSRRDLALSM TSKPRRLVFGGASFSALFPCVESSSTDASHPSARASRAAKARTSAQETTPKQAVSRRDLALSMT SKPRRLVFGGASFSALFPCVESSSTDASHPSARASRAAKARTSAQETTPKQAVSRRDLALSMTS KPRRLVFGGASFSALFPCVESSSTDASH(+) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Chu et al., 2017 |