Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os03g0121200_circ_g.1 |
| ID in PlantcircBase | osa_circ_017646 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr3: 1175001-1175189 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | ei-circRNA |
| Identification method | CIRCexplorer, KNIFE, PcircRNA_finder |
| Parent gene | Os03g0121250 |
| Parent gene annotation |
Hypothetical protein. (Os03t0121250-00) |
| Parent gene strand | + |
| Alternative splicing | NA |
| Support reads | 17 |
| Tissues | root, anther |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Os03t0121200-03:1 Os03t0121200-02:1 Os03t0121200-01:1 Os03t0121200-03:1 Os03t0121250-00:1 Os03t0121200-02:1 Os03t0121200-01:1 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.315826543 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
1175096-1175186(+) |
| Potential amino acid sequence |
MTSKPRRLVFGGASFSALFPCVESSSTDASHPSARASRAAKARTSAQETTPKQAVSRRDLALSM TSKPRRLVFGGASFSALFPCVESSSTDASHPSARASRAAKARTSAQETTPKQAVSRRDLALSMT SKPRRLVFGGASFSALFPCVESSSTDASHPSARASRAAKARTSAQETTPKQAVSRRDLALSMTS KPRRLVFGGASFSALFPCVESSSTDASH(+) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |